Application
Anti-LMNB2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25µg/ml.
Biochem/physiol Actions
LMNB2 (lamin B2) gene also referred to as LAMB2, LMN2, or MGC2721 encodes for a B type nuclear lamin. Lamins consist of two types, A and B, and are involved in nuclear stability chromatin structure and gene expression. Lamin B which is a structural component of the interphase nuclear lamina facilitates the stimulation of microtubule assembly and organization in mitosis. Mutation in LMNB2 gene leads to acquired partial lipodystrophy.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human LMNB2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE
This product has met the following criteria to qualify for the following awards: