Biochem/physiol Actions

ZRANB2 is a splice factor required for alternative splicing of SFRS10/TRA2B transcripts. It may interfere with constitutive 5′-splice site selection. Zinc finger Ran-binding domain containing protein 2 (ZRANB2) promotes differential splicing of numerous primary transcripts. Alternative splicing of transcripts might be associated with cancer. ZRANB2 is upregulated in grade III ovarian serous papillary carcinoma. The C-terminal interacts with spliceosomal proteins and the N- terminal helps in RNA recognition.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Zinc finger ran-binding domain containing protein 2 (ZRANB2) is a part of supraspliceosome. It is present in the nucleus of human cells. This protein contains a C-terminal arginine/serine rich domain and two N-terminal RanBP2-type zinc fingers. ZRANB2gene is located on human chromosome 1p31.1.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZRANB2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESD