Application
Rabbit Anti-ZNF258 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml and IHC assays at 4-8 µg/ml.
Biochem/physiol Actions
ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ZNF258 (ZMYM6) codes for a zinc finger protein that contains the zinc-binding motif, MYM.Rabbit Anti-ZNF258 antibody recognizes human and canine ZNF258.
Immunogen
Synthetic peptide directed towards the middle region of human ZNF258
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAKIIQDESTQEDAMKF
This product has met the following criteria to qualify for the following awards: