Application
Rabbit Anti-ZMyND11 (AB1) antibody is suitable for western blot (2.5 µg/ml) and IHC (4-8 µg/ml) assays.
Biochem/physiol Actions
ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ZMyND11 is a zinc-finger protein that links H3, 3K36me3 to tumor suppression and transcriptional elongation. ZMyND11 has also been implicated in poorly differentiated myeloid leukemia.Rabbit Anti-ZMyND11 antibody recognizes bovine, chicken, human, mouse, rat, and canine ZMyND11.
Immunogen
Synthetic peptide directed towards the middle region of human ZMYND11
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV
This product has met the following criteria to qualify for the following awards: