Anti-TRP63

Code: SAB2106321-100UL D2-231

Biochem/physiol Actions

This gene encodes tumor protein p63, a member of the p53 family of transcription factors involved in cellular responses to stress and development. The...


read more

Your Price
€582.40 100UL
Discontinued
€716.35 inc. VAT

Biochem/physiol Actions

This gene encodes tumor protein p63, a member of the p53 family of transcription factors involved in cellular responses to stress and development. The family members include tumor proteins p53, p63, and p73, which have high sequence similarity to one another. This similarity allows p63 and p73 to transactivate p53-responsive genes causing cell cycle arrest and apoptosis. The family members can interact with each other in many ways, including direct and indirect protein interactions. This results in mutual regulation of target gene promoters. Tumor protein p63 -/- mice have several developmental defects which include the lack of limbs and other tissues, such as teeth and mammary glands, which develop as a result of interactions between mesenchyme and epithelium.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-TRP63 antibody: synthetic peptide derected towards the middle region of human TRP63

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNGDGT

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TP63(8626)
mol wt50 kDa
NCBI accession no.NM_018790
Quality Level100
shipped inwet ice
species reactivityhuman, bovine, rabbit, horse, guinea pig, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9H3D4
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.