SAB2102529-100UL Display Image

Anti-TRAF1

Code: SAB2102529-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...

read more

€532.97 100UL
List Price

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TRAF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
species reactivitymouse, dog, horse, rabbit, bovine, human
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
UniProt accession no.Q13077
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
mol wt46 kDa
conjugateunconjugated
Gene Informationhuman ... TRAF1(7185)
formbuffered aqueous solution