SAB2102525-100UL Display Image

Anti-TPST2

Code: SAB2102525-100UL D2-231

Biochem/physiol Actions

TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golg...

read more

€532.97 100UL
List Price

Biochem/physiol Actions

TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TPST2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
concentration0.5 mg - 1 mg/mL
UniProt accession no.O60704
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
mol wt42 kDa
conjugateunconjugated
species reactivityguinea pig, dog, mouse, bovine, rabbit, rat, human, horse
Gene Informationhuman ... TPST2(8459)
formbuffered aqueous solution