SAB2102520-100UL Display Image

Anti-TPH2

Code: SAB2102520-100UL D2-231

Application

Anti-TPH2 antibody produced in rabbit has been used in Western blot analysis.

Biochem/physiol Actions

Tryptophan hydroxylase (TPH; EC...

read more

€532.97 100UL
List Price

Application

Anti-TPH2 antibody produced in rabbit has been used in Western blot analysis.

Biochem/physiol Actions

Tryptophan hydroxylase (TPH; EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility. This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. The human genome contains two related tryptophan hydroxylases, one on chromosome 11p15-p14 and one on chromosome 12q21. This gene is expressed predominantly in the brain stem. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by the mouse ortholog. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1805 AY098914.1 1-1805 1806-2360 AC090109.15 122981-123535

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TPH2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
Gene Informationhuman ... TPH2(121278)
UniProt accession no.Q8IWU9
concentration0.5 mg - 1 mg/mL
species reactivityrabbit, rat, dog, guinea pig, human, bovine, mouse
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
mol wt56 kDa
formbuffered aqueous solution