SAB2102519-100UL Display Image

Anti-TPD52

Code: SAB2102519-100UL D2-231

Biochem/physiol Actions

It belongs to the TPD52 family. Its exact function remains unknown.

Disclaimer

Unless otherwise stated in our catalog or ...

read more

€532.97 100UL
List Price

Biochem/physiol Actions

It belongs to the TPD52 family. Its exact function remains unknown.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TPD52

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG

mol wt24 kDa
species reactivitymouse, bovine, guinea pig, rabbit, human, rat, horse
application(s)western blot: suitable
application(s)immunohistochemistry: suitable
clonepolyclonal
antibody formaffinity isolated antibody
concentration0.5 mg - 1 mg/mL
UniProt accession no.P55327
storage temp.−20°C
Quality Level100
Gene Informationhuman ... TPD52(7163)
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
formbuffered aqueous solution