SAB2102518-100UL Display Image

Anti-TP73

Code: SAB2102518-100UL D2-231

Biochem/physiol Actions

TP73 belongs to the p53 family. It participates in the apoptotic response to DNA damage. When overproduced, it activates transcription from p53-respon...

read more

€532.97 100UL
List Price

Biochem/physiol Actions

TP73 belongs to the p53 family. It participates in the apoptotic response to DNA damage. When overproduced, it activates transcription from p53-responsive promoters and induces apoptosis. TP53 may be a tumor suppressor protein. This gene encodes tumor protein p73, which is a member of the p53 family of transcription factors involved in cellular responses to stress and development. The family members include p53, p63, and p73 and have high sequence similarity to one another, which allows p63 and p73 to transactivate p53-responsive genes causing cell cycle arrest and apoptosis. The family members can interact with each other in many ways involving direct or indirect protein interactions, resulting in regulation of the same target gene promoters or regulation of each other′s promoters. The p73 protein is expressed at very low levels in normal tissues and is differentially expressed in a number of tumors. The p73 gene expresses at least 35 mRNA variants due to the use of alternate promoters, alternate translation initiation sites, and multiple splice variations. Theoretically this can account for 29 different p73 isoforms; however, the biological validity and the full-length nature of most variants have not been determined.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TP73

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDV

UniProt accession no.O15350
application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
mol wt69 kDa
concentration0.5 mg - 1 mg/mL
species reactivitybovine, human, dog
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
Gene Informationhuman ... TP73(7161)
formbuffered aqueous solution