Application
Anti-TP53 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)
Biochem/physiol Actions
TP53 is a tumor suppressor protein essential for protection against development of cancer. Mutations in the TP53 gene or alterations in function of the protein result in predisposition to colorectal cancer, gastric and esophageal cancers. TP53 also acts as a transcription factor and maintains the genetic stability preventing malignant transformation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human TP53
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPD
This product has met the following criteria: