Application
Rabbit Anti-TKT antibody is suitable for western blot applications at a concentration of 1µg/ml.
Biochem/physiol Actions
TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TKT codes for transketolase which is involved in directing excess sugar phosphates to glycolytic pathways. Studies in mice have shown that oxidative stress may modulate TKT gene regulation in cornea.Rabbit Anti-TKT antibody regulates human, mouse, rat, pig, zebrafish, and bovine TKT.
Immunogen
Synthetic peptide directed towards the N terminal region of human TKT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
This product has met the following criteria to qualify for the following awards: