Application
Anti-TGFBI polyclonal antibody is used to tag transforming growth factor, β 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β 1 in cell signaling within a wide range of cell types.
Biochem/physiol Actions
TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Transforming growth factor, β-induced, 68 kDa (TGFB1, BIGH3, CDB1, CDG2, CDGG1, CSD) is a cell signaling protein with a wide range of functions, mostly as a negative/suppressive modulator of cell growth. TGFB1 is a modulator of immune function and an inducer of cell transformation. The actions of TGFB1 are mediated via transforming growth factor β receptors.
Immunogen
Synthetic peptide directed towards the C terminal region of human TGFBI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Specificity
Anti-TGFBI polyclonal antibody reacts with chicken, human, mouse, rat, bovine, pig, and rabbit transforming growth factor, β 1 proteins.
This product has met the following criteria to qualify for the following awards: