Anti-TFAP2E

Code: AV40023-100UL D2-231

Application

Anti-TFAP2E polyclonal antibody is used to tag transcription factor AP-2 epsilon for detection and quantitation by Western blotting and in plasma by immunohistoch...


read more

Your Price
€470.60 100UL
Discontinued
€578.84 inc. VAT

Application

Anti-TFAP2E polyclonal antibody is used to tag transcription factor AP-2 epsilon for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transcription factor AP-2 epsilon in skin development and colorectal cancer chemoresistance.

Biochem/physiol Actions

TFAP2E belongs to AP-2 family of transcription factors which play an important role in regulating gene expression during development and differentiation of multiple organs and tissues. It may play an important role in skin biology.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The AP2 family of transcription factors is expressed during mammalian development, morphogenesis and in various malignancies. Transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon) (TFAP2E, AP2epsilon) is expressed in skin and keratinocytes and melanocytes implicating it as a regulator of skin biology function such as melanophore differentiation. TFAP2E epigenetic modification has been implicated in colorectal cancer chemoresistance.

Immunogen

Synthetic peptide directed towards the C terminal region of human TFAP2E

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK

Specificity

Anti-TFAP2E polyclonal antibody reacts with mouse, rat, human, and bovine transcription factor AP-2 epsilon proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TFAP2E(339488)
mol wt45 kDa
NCBI accession no.NP_848643
Quality Level100
shipped inwet ice
species reactivityguinea pig, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IW12
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.