Application
Anti-ST6GALNAC2 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Biochem/physiol Actions
ST6GALNAC2 is primarily expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes. Overexpression of ST6GALNAC2 abolishes the cell surface HECA-452/CLA expression, reduces the number of rolling leukocytes on P- and L-selectin-bearing substrates as well as enhances the median rolling velocity of remaining cells during the synthesis of the leukocyte selectin ligand on human P-selectin glycoprotein ligand-1. Increased expression of the sialyltransferase ST6GalNAc-II indirectly reduces the galactosylation of the O-glycan substrate.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase is an enzyme encoded by the ST6GALNAC2 gene in humans. It belongs to the family of sialyltransferases. It is found in various human cell lines and is also expressed in most cell types with notable exceptions for several myeloid and lymphoid cell lines.
Immunogen
Synthetic peptide directed towards the middle region of human ST6GALNAC2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
This product has met the following criteria to qualify for the following awards: