Application

Anti-SRP14 polyclonal antibody is used to tag signal recognition particle 14 kDa for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of signal recognition particle 14 kDa in ribonucleoprotein structure and function.

Biochem/physiol Actions

SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Signal recognition particle 14 kDa (homologous Alu RNA binding protein) (SRP14) is a component of eukaryotic signal recognition particle (SRP) ribonucleoprotein that directs the traffic of proteins within cells and allows them to be secreted. The heterodimeric subunit, SRP9/14, of the signal recognition particle (SRP) bind to scALu and scB1 RNAs.

Immunogen

Synthetic peptide directed towards the N terminal region of human SRP14

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL

Specificity

Anti-SRP14 polyclonal antibody reacts with human, canine, chicken, bovine, mouse, zebrafish, and rat signal recognition particle 14 kDa proteins.