Anti-SPIB

Code: AV31422-100UL D2-231

Application

Rabbit Anti-SPIB antibody can be used for western blot applications at 0.25µg/ml.

Biochem/physiol Actions

SPI1 (MIM 165170) and ...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Rabbit Anti-SPIB antibody can be used for western blot applications at 0.25µg/ml.

Biochem/physiol Actions

SPI1 (MIM 165170) and SPIB are members of a subfamily of ETS (see ETS1; MIM 164720) transcription factors. ETS proteins share a conserved ETS domain that mediates specific DNA binding. SPIB and SPI1 bind to a purine-rich sequence, the PU box (5-prime-GAGGAA-3-prime).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SPIB is a transcriptional stimulator that associates with PU-box and functions as a lymphoid enhancer. SPIB variants have been linked to primary biliary cirrhosis.Rabbit Anti-SPIB antibody recognizes zebrafish, canine, pig, bovine, chicken, human, mouse, and rat SPIB.

Immunogen

Synthetic peptide directed towards the C terminal region of human SPIB

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SPIB(6689)
mol wt19 kDa
NCBI accession no.NP_003112
Quality Level100
shipped inwet ice
species reactivityhuman, bovine, rabbit, rat, mouse, guinea pig, dog, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q01892
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.