Application
Anti-SLC6A8 polyclonal antibody is used to tag solute carrier family 6 (neurotransmitter transporter, creatine), member 8for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 6 (neurotransmitter transporter, creatine), member 8 in creatine homeostasis and the development of creatine-deficiency syndrome.
Biochem/physiol Actions
SLC6A8 is required for the uptake of creatine in muscles and brain.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Solute carrier family 6 (neurotransmitter transporter, creatine), member 8/sodium- and chloride-dependent creatine transporter 1 (SLC6A8, CRTR, CT1) is required for the cellular uptake of creatine, which facilitates the storage of energy as ATP. Defects in SLC6A8/CRTR leads to creatine-deficiency syndrome evidenced by mental retardation and language delay.
Immunogen
Synthetic peptide directed towards the N terminal region of human SLC6A8
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
Specificity
Anti-SLC6A8 polyclonal antibody reacts with bovine, canine, human, mouse, rat, pig, and rabbit sodium- and chloride-dependent creatine transporter 1 proteins
This product has met the following criteria to qualify for the following awards: