Biochem/physiol Actions
Solute carrier family 2 member 8 (SLC2A8)/glucose transporter 8 (GLUT8) plays a key role in modulating the transport of fructose and the utilization of mammalian fructose. It is a trehalose transporter found in mammals that is necessary for trehalose-induced autophagy. SLC2A8 can also transport intracellular hexose. Hence, it might serve as a multifunctional sugar transporter.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Solute carrier family 2 member 8 (SLC2A8)/Glucose transporter 8 (GLUT8), a class III sugar transporter, is expressed in the testis and brain. In the brain, GLUT8 is expressed mainly in the cerebral cortex, hippocampus, amygdala, and hypothalamus.
Immunogen
Synthetic peptide directed towards the middle region of human SLC2A8
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
This product has met the following criteria to qualify for the following awards: