Application
Anti-SLC2A10 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.
Biochem/physiol Actions
SLC2A10 (GLUT10) is a facilitative glucose transporter that regulates glucose homeostasis. The activity of GLUT10 is essential for developmental regulation by TGF-β, cardiovascular development, mitochondrial respiration and metabolism. Polymorphisms in the gene encoding this protein have been observed in Caucasian Americans with type 2 diabetes and in patients with arterial tortuosity syndrome.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human SLC2A10
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
This product has met the following criteria to qualify for the following awards: