Biochem/physiol Actions

SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter. Sideroflexin 4 (SFXN4) mutations are known to causemitochondriopathy and macrocytic anemia. SFXN4is required for maintaining mitochondrial respiratory homeostasis and erythropoiesis. SFXN4is upregulated in ovarian cancer patients.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Sideroflexin 4 (SFXN4) is a mitochondrial protein, localized in inner mitochondrial membrane. SFXN4 gene is located on human chromosome 10q26.11.

Immunogen

Synthetic peptide directed towards the C terminal region of human SFXN4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV