Anti-ROBO2

Code: SAB2102037-100UL D2-231

Biochem/physiol Actions

ROBO2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. ROBO2 is a receptor for...


read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Biochem/physiol Actions

ROBO2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. ROBO2 is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for ROBO2.This gene belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. The encoded protein is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ROBO2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ROBO2(6092)
mol wt151 kDa
Quality Level100
shipped inwet ice
species reactivityhorse, human, bovine, dog, rat, guinea pig, rabbit, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9HCK4
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.