Application
Anti-RFC5 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/ml and for immunohistochemistry at a concentration of 4-8µg/ml.
Biochem/physiol Actions
Replication factor C (RFC), also referred to as activator 1, is a protein complex comprising of five distinct subunits of 140, 40, 38, 37, and 36kDa. DNA polymerase delta and epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C for elongation of primed DNA templates. RFC5 gene encodes the 36kDa subunit that forms the core complex along with the 38 and 40kDa subunits. It also interacts with proliferating cell nuclear antigen (PCNA) and preserves modified PCNA from phosphorylation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human RFC5
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE
This product has met the following criteria to qualify for the following awards: