Application
Anti-RB1CC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.
Biochem/physiol Actions
RB1-inducible coiled-coil 1 (RB1CC1; ATG17) enhances the expression of retinoblastoma 1 gene in cancer cells. It coordinates with signaling pathways involved in cell growth, proliferation, apoptosis and migration. RB1CC1 exhibits tumor-suppressive functions in prostate cancer cells.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human RB1CC1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
This product has met the following criteria to qualify for the following awards: