Application

Rabbit Anti-PYGO1 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

PYGO1 contains 1 PHD-type zinc finger. PYGO1 is involved in signal transduction through the Wnt pathway.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

PYGO1 codes for pygopus family PHD finger 1. Studies in mice have revealed that Pygo1 is needed for branching morphogenesis during renal development. It is also involved in Wnt signaling pathways.Rabbit Anti-PYGO1 antibody recognizes human, mouse, zebrafish, and chicken PYGO1.

Immunogen

Synthetic peptide directed towards the N terminal region of human PYGO1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAANPFDDN