Application

Rabbit anti- PSMC3IP antibody is suitable for western blot applications at a concentration of 1.25µg/ml.

Biochem/physiol Actions

PSMC3IP plays an important role in meiotic recombination. It stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. It may inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

PSMC3IP (HOP2) forms a part of the PSMC3IP/MND1 complex that associates with PSMC3/TBP1 and regulates strand exchange during meiotic recombination. A mutation in PSMC3IP has been associated with XX ovarian dysgenesis.Rabbit anti- PSMC3IP antibody recognizes canine, human, bovine, rat, and mouse PSMC3IP.

Immunogen

Synthetic peptide directed towards the middle region of human PSMC3IP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP