Application

Anti-PLCD1 (ab1) antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

Phospholipase C-δ1 (PLCD1) is involved in the regulation of energy metabolism, calcium homeostasis and intracellular movement. It plays a crucial role in the phosphoinositide metabolism by hydrolyzing phosphatidylinositol-4, 5-bisphosphate to inositol 1, 4, 5 trisphosphate (IP3) and diacylglycerol. It has been studied that PLCD1 also possess tumor suppressive property in gastric cancer and breast cancer. Mutations in PLCD1 gene have been linked to a rare nail disorder, hereditary leukonychia.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Phospholipase C-δ1 (PLCD1) is located in chromosome 3p21.3-p22 in humans. It is expressed in all normal adult tissues and is abundantly present in human nail matrix. Its functional attribute is highly dependent on intracellular free calcium concentration.

Immunogen

Synthetic peptide directed towards the N terminal region of human PLCD1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH