Application
Rabbit Anti-PIAS3 antibody can be used for western blot (1.0-2.0 µg/ml) and IHC (4-8 µg/ml) applications.
Biochem/physiol Actions
PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
PIAS3 is a transcription factor that facilitates protein SUMOylation. It inhibits STAT3-mediated signaling and studies have reported that its overexpression can induce apoptosis in prostate cancer cells. PIAS3 can also function as a biomarker for human cancer.Rabbit Anti-PIAS3 antibody recognizes human, rat, canine, mouse, and bovine PIAS3.
Immunogen
Synthetic peptide directed towards the C terminal region of human PIAS3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV
This product has met the following criteria to qualify for the following awards: