Biochem/physiol Actions

The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone.The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone (Saiki et al., 2005 [PubMed 16262699]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5′ end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-24 DC341808.1 2-25 25-1292 BC039906.1 11-1278 1293-2534 AL832290.1 98-1339 2535-2535 BC039906.1 2521-2521 2536-3522 AL832290.1 1340-2326 3523-3568 AL832290.1 2328-2373

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human PDSS2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS