Anti-OCIAD1

Code: AV48378-100UL D2-231

Application

Rabbit Anti-OCIAD1 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

OCIA...


 Read more

Your Price
€449.00 100UL
€552.27 inc. VAT

Application

Rabbit Anti-OCIAD1 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer. Effect of OCIAD1 on cell adhesion may be related to its function in ovarian cancer. Possibily, OCIAD1 may play a role in tumor metastasis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

OCIAD1 codes for an OCIA domain-containing protein that is involved in ovarian cancer cell adhesion. Its expression in differentiated thyroid carcinoma has been correlated to metastasis risk.Rabbit Anti-OCIAD1 antibody recognizes canine, bovine, human, mouse, and rat OCIAD1.

Immunogen

Synthetic peptide directed towards the C terminal region of human OCIAD1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... OCIAD1(54940)
mol wt27 kDa
NCBI accession no.NP_001073308
Quality Level100
shipped inwet ice
species reactivityhorse, rat, guinea pig, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NX40
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.