Application
Rabbit Anti-NUDCD1 antibody is suitable for western blot applications at a concentration of 1µg/ml.
Biochem/physiol Actions
NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
NUDCD1 (CML66) codes for an NUDCD1 domain containing protein that is expressed in the cytoplasm. This protein is mainly expressed in the testis and solid tumors. Studies have reported that it is an immunogenic tumor antigen which is associated with chronic myelogenous leukemia.Rabbit Anti-NUDCD1 antibody recognizes canine, chicken, human, mouse, rat, and bovine NUDCD1.
Immunogen
Synthetic peptide directed towards the N terminal region of human NUDCD1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY
This product has met the following criteria to qualify for the following awards: