Anti-NR1I2

Code: AV39532-100UL D2-231

Application

Rabbit Anti-NR1I2 antibody is suitable for western blot applications at a concentration of 5 µg/ml.

Biochem/physiol Actions

NR1I...


read more

Your Price
€470.60 100UL
Discontinued
€578.84 inc. VAT

Application

Rabbit Anti-NR1I2 antibody is suitable for western blot applications at a concentration of 5 µg/ml.

Biochem/physiol Actions

NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. NR1I2 contains a zinc finger domain.NR1I2 is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. The gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. The gene product contains a zinc finger domain. Three alternatively spliced transcripts that encode different isoforms have been described, one of which encodes two products through the use of alternative translation initiation codons. Additional transcript variants derived from alternative promoter usage, alternative splicing, and/or alternative polyadenylation exist, but they have not been fully described.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NR1I2 (PXR) is a transcription factor that belongs to the nuclear receptor family. It associates with the CYP3A4 promoter and the 9-cis retinoic acid receptor RXR. Genetic variations in NR1I2 have been linked to inflammatory bowel disease, lymphoma, and tacrolimus pharmacokinetics.Rabbit Anti-NR1I2 antibody recognizes pig, canine, human, mouse, rat, bovine, and rabbit NR1I2.

Immunogen

Synthetic peptide directed towards the C terminal region of human NR1I2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGI

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NR1I2(8856)
mol wt54 kDa
NCBI accession no.NP_071285
Quality Level100
shipped inwet ice
species reactivitypig, human, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UNW4
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.