Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Immunohistochemistry (1 paper)
Biochem/physiol Actions
Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Myb-binding protein 1A, MyBBP1A, binds to leucine zipper motifs in various proteins including JUN and MyB to regulate transcription. It is a 148 kDa protein expressed in the cytoplasm but it is also found in the nucleus where it is believed to get translocated by KPNA2.
Immunogen
Synthetic peptide directed towards the C terminal region of mouse MYBBP1A
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
This product has met the following criteria to qualify for the following awards: