Application

Rabbit Anti-MSX1 (AB1) antibody can be used for western blot (2.0µg/ml) and immunohistochemistry (4-8µg/ml) applications.

Biochem/physiol Actions

Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

MSX1 is a homeobox gene that functions as a transcriptional repressor during embryogenesis. MSX1 mutations have been linked to tooth agenesis and orofacial clefting.Rabbit Anti-MSX1 (AB1) antibody recognizes canine, rat, mouse, pig, and human MSX1.

Immunogen

Synthetic peptide directed towards the middle region of human MSX1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF