Biochem/physiol Actions

Mixed lineage kinase domain-like protein (MLKL) primarily causes receptor-interacting protein (RIP) kinase–dependent necroptosis. However, during hepatitis, it results in programmed hepatocellular necrosis which is independent of RIPK3.s MLKL also participates in endosomal trafficking and in the formation of extracellular vesicles.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Mixed lineage kinase domain-like protein (MLKL) is encoded by the gene mapped to human chromosome 16q23. Activated MLKL is localized on the cell membrane.

Immunogen

Synthetic peptide directed towards the N terminal region of human MLKL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE