Application
Anti-LYK5 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.
Biochem/physiol Actions
LYK5 is also known as STE20-related kinase adaptor alpha (STRADA) is a pseudokinase that activates STK11 and prevents it from entering the nucleus. It has a regulatory role in STK11-mediated cell cycle arrest in G1 phase. Mutations in gene encoding LYK5 are associated with PMSE syndrome (polyhydramnios, megalencephaly and symptomatic epilepsy).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human LYK5
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV
This product has met the following criteria to qualify for the following awards: