Anti-LIAS

Code: AV48717-100UL D2-231

Application

Rabbit Anti-LIAS antibody is suitable for western blot applications at a concentration of 0.25 µg/ml.

Biochem/physiol Actions

LI...


 Read more

Your Price
€449.00 100UL
€552.27 inc. VAT

Application

Rabbit Anti-LIAS antibody is suitable for western blot applications at a concentration of 0.25 µg/ml.

Biochem/physiol Actions

LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.The protein encoded by this gene belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Lipoic acid synthetase (LIAS) a mitochondrial protein that catalyzes the synthesis of α-(+)-lipoic acid synthesis. Deficiency of LIAS is linked to glycine elevation, defects in mitochondrial energy metabolism and neonatal-onset epilepsy.Rabbit Anti-LIAS antibody recognizes human, mouse, and rat LIAS antibody.

Immunogen

Synthetic peptide directed towards the C terminal region of human LIAS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LIAS(11019)
mol wt39 kDa
NCBI accession no.NP_006850
Quality Level100
shipped inwet ice
species reactivityyeast, mouse, human, guinea pig, dog, bovine, rabbit, rat, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O43766
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.