Anti-KCNN2

Code: AV35094-100UL D2-231

Application

Rabbit Anti-KCNN2 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

A...


 Read more

Your Price
€337.00 100UL
€414.51 inc. VAT

Application

Rabbit Anti-KCNN2 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

KCNN2 codes for an integral membrane protein that forms a part of a voltage-independent calcium-activated channel. KCNN2 deletions have been implicated in behavioural defects.Rabbit Anti-KCNN2 antibody recognizes human, mouse, rat, bovine, pig, chicken, canine, and zebrafish KCNN2.

Immunogen

Synthetic peptide directed towards the C terminal region of human KCNN2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KCNN2(3780)
mol wt64 kDa
NCBI accession no.NP_067627
Quality Level100
shipped inwet ice
species reactivityhuman, yeast
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9H2S1
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.