Application

Rabbit Anti-IVL antibody is suitable for western blot applications at a concentration of 0.5µg/ml.

Biochem/physiol Actions

Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase.Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. This gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and calcyclin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Involucrin (IVL) is a part of the keratinocyte envelope that is found in the cell cytoplasm. It has been studied as a marker of keratinocyte differentiation. It is a biomarker for epithelial-mesenchymal transition in squamous cell carcinoma.Rabbit Anti-IVL antibody recognizes human, and bovine IVL.

Immunogen

Synthetic peptide directed towards the N terminal region of human IVL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE