Biochem/physiol Actions

Ikaros positively regulates lymphocyte differentiation and negatively regulates cell proliferation. It plays a role in peripheral lymphocyte homeostasis and negatively regulates follicular B cell activation. Ikaros/IKZF1 is involved in the development of myeloid cells such as red blood cells, platelets, basophils, and neutrophils. Mutations in the IKZF1 gene lead to acute lymphoblastic leukemia (ALL). Downregulation of the IKZF1 gene is observed in the peripheral blood mononuclear cells of systemic lupus erythematosus (SLE) patients. IKZF1 binds and activates the enhancer (delta-A element) of the CD3-delta gene. It functions in the specification and the maturation of the T-lymphocyte. It also interacts with a critical control element in the terminal deoxynucleotidyltransferase (TDT) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The Ikaros family zinc finger 1 (IKZF1) gene encodes for the Ikaros transcription factor, and is expressed throughout hematopoiesis. IKZF1 protein is made of an N-terminal DNA-binding domain (DBD) and a C-terminal dimerization domain. The IKZF1 gene is mapped on the human chromosome at 7p12.2.

Immunogen

Synthetic peptide directed towards the middle region of human IKZF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK