Anti-HOXB9

Code: AV32639-100UL D2-231

Application

Rabbit Anti-HOXB9 antibody has been used to detect Hoxb9 in bovine in embryos using whole-mount immunofluorescence and western blot techniques. The antibody has a...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Rabbit Anti-HOXB9 antibody has been used to detect Hoxb9 in bovine in embryos using whole-mount immunofluorescence and western blot techniques. The antibody has also been used at a dilution of 1:50 for immunohistochemical analysis in papillary thyroid carcinomas.

Biochem/physiol Actions

HOXB9 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. HOXB9 is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HOXB9 is a homeobox transcription factor that regulates cell growth and differentiation. HOXB9 is expressed throughout early bovine embryogenesis and has been implicated in thyroid cancer.Rabbit Anti-HOXB9 antibody recognizes human, mouse, rat, bovine, and canine HOXB9.

Immunogen

Synthetic peptide directed towards the N terminal region of human HOXB9

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HOXB9(3219)
mol wt28 kDa
NCBI accession no.NP_076922
Quality Level100
shipped inwet ice
species reactivityhuman, pig, rabbit, horse, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P17482
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.