Application

Anti-GLA antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

GLA gene encodes a homodimeric glycoprotein that hydrolyzes the terminal α-galactosyl moieties from glycolipids and glycoproteins. It also plays a role in catalysing hydrolysis of melibiose into galactose and glucose. Mutation in GLA gene results in fabry disease, a rare lysosomal storage disorder associated with failure to catabolize α-D-galactosyl glycolipid moieties.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human GLA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF