Application

Rabbit Anti-GBX2 antibody can be used for western blot applications at a concentration of 1.25µg/ml.

Biochem/physiol Actions

Altered expression of GBX2, part of the homeobox-containing human family of DNA-binding transcription factors, is associated with therapy failure and death in patients with multiple types of cancer.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Gbx2 is a homeobox transcription factor. Studies have reported that Gbx2 is required for the development of mid/hindbrain region in mouse embryos. Gbx2 has also been implicated in Otx2 repression.Rabbit Anti-GBX2 antibody recognizes rat, human, bovine, canine, and mouse GBX2.

Immunogen

Synthetic peptide directed towards the middle region of human GBX2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE