Anti-GABRE

Code: AV35342-100UL D2-231

Application

Rabbit Anti-GABRE antibody is suitable for western blot applications at a concentration of 2.0 µg/ml.

Biochem/physiol Actions

GA...


 Read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Application

Rabbit Anti-GABRE antibody is suitable for western blot applications at a concentration of 2.0 µg/ml.

Biochem/physiol Actions

GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

GABRE is a ligand-gated ion-channel that codes for the ε subunit of γ-aminobutyric acid (GABA) A receptor. Rabbit anti-GABRE antibody reacts with mouse, human, and rat GABRE.

Immunogen

Synthetic peptide directed towards the middle region of human GABRE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GABRE(2564)
mol wt43 kDa
NCBI accession no.NP_004952
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P78334
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.