Anti-GABRA2

Code: AV13026-100UL D2-231

Application

Rabbit polyclonal anti-GABRA2 antibody is used to tag Gamma-Aminobutyric acid (GABA) A receptor, α-2 for detection and quantitation by immunocytochemical and...


 Read more

Your Price
€350.00 100UL
€430.50 inc. VAT

Application

Rabbit polyclonal anti-GABRA2 antibody is used to tag Gamma-Aminobutyric acid (GABA) A receptor, α-2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Gamma-Aminobutyric acid (GABA) A receptor, α-2 in alcohol dependency/alcoholism. Anti-GABRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 µg/ml.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

GABA-A is a receptor for the major inhibitory neurotransmitter in mammalian brain, gamma-aminobutyric acid (GABA). Gamma-Aminobutyric acid (GABA) A receptor, α-2 (GABRA2) is one of sixteen subunits of GABA-A receptors currenly identified. Variants in GABRA2 have been cautiously associated with alcoholism.

Rabbit polyclonal anti-GABRA2 antibody reacts with canine, bovine, human, mouse, and rat Gamma-Aminobutyric acid (GABA) A receptor, α-2 subunits.

Immunogen

Synthetic peptide directed towards the middle region of human GABRA2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GABRA2(2555)
mol wt51 kDa
NCBI accession no.NP_000798
Quality Level100
shipped inwet ice
species reactivityhorse, bovine, rat, dog, mouse, rabbit, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P47869
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.