Application
Rabbit Anti-FOSL2 antibody can be used for immunohistochemical (4-8µg/ml) and western blot (0.2-0.5µg/ml) applications.
Biochem/physiol Actions
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2, which encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
FOS proteins are known to modulate cell growth and differentiation. FOSL2 is a leucine zipper transcription factor that regulates leptin expression in adipocytes. Rabbit Anti-FOSL2 antibody recognizes zebrafish, human, chicken, mouse, rat, canine, and bovine FOSL2.
Immunogen
Synthetic peptide directed towards the middle region of human FOSL2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY
This product has met the following criteria to qualify for the following awards: