Application

Rabbit Anti-EYA3 antibody can be used for IHC (4-8µg/ml) and western blot (0.05-1.0µg/ml) applications.

Biochem/physiol Actions

Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

EYA3 interacts with Six1 and subsequently activates TSHβ expression in response to light changes in the photoperiodic system of mice. EYA3 expression has also been implicated in Ewing sarcoma.Rabbit Anti-EYA3 antibody recognizes human, mouse, rat, and canine EYA3.

Immunogen

Synthetic peptide directed towards the middle region of human EYA3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA