Anti-ETS1

Code: AV100604-100UL D2-231

Application

Anti-ETS1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml. For immunohistochemistry of paraffin-embedded tissue se...


 Read more

Your Price
€305.00 100UL
€375.15 inc. VAT

Application

Anti-ETS1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.

Biochem/physiol Actions

The DNA-binding activity of ETS1 requires the phosphorylation at Thr38 by ERK1/2. ETS1 is expressed in a variety of cell types including hematopoietis cells, endothelial cells, epithelial cancer cells and vascular smooth muscle cells. ETS1 promotes cell invasion and angiogenesis as it regulates the transcription of VEGF and MMP genes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ETS1 belongs to the Ets family of transcription factors that are crucial mediators of extracellular matrix remodeling. The Ets family members are regulators of bone and cartilage development.

Immunogen

Synthetic peptide directed towards the N terminal region of human ETS1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ETS1(2113)
mol wt50 kDa
NCBI accession no.NP_001137292
Quality Level100
shipped inwet ice
species reactivityrabbit, human, guinea pig, rat, mouse, bovine, dog, horse, goat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P14921
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.