Anti-ESRRG

Code: AV31655-100UL D2-231

Application

Rabbit ESRRG antibody has been used for co-immunoprecipitation and western blot assays. Sigma has verified the use of the product in western blot (0.5μg/ml) and i...


 Read more

Your Price
€412.00 100UL
€506.76 inc. VAT

Application

Rabbit ESRRG antibody has been used for co-immunoprecipitation and western blot assays. Sigma has verified the use of the product in western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissue sections) applications.

Biochem/physiol Actions

ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ESRRG (or ERRgamma) is a transcriptional activator of Dnmt1 expression in humans and mice. This transcription factor has also been implicated in renal papilla development, as well as in lipid and lipoprotein metabolism.Rabbit ESRRG antibody recognizes bovine, human, mouse, rat, zebrafish, canine, and chicken ESRRG.

Immunogen

Synthetic peptide directed towards the middle region of human ESRRG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ESRRG(2104)
mol wt51 kDa
NCBI accession no.NP_001127757
Quality Level100
shipped inwet ice
species reactivityrabbit, bovine, rat, dog, guinea pig, human, horse, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P62508
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.