Application
Anti-EPB41L2 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Biochem/physiol Actions
The protein encoded by this gene interacts with the C-terminus of G protein-coupled receptors (GPCRs) and regulates intracellular distribution of the receptors, including parathyroid hormone.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
The gene EPB41L2 maps to human chromosome 6q23 and is widely expressed among human tissues. The gene encodes a 113-kDa protein that exhibits three regions of high homology to EPB41, including the membrane binding domain, the spectrin–actin binding domain, and the C-terminal domain.
Immunogen
Synthetic peptide directed towards the middle region of human EPB41L2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST
This product has met the following criteria to qualify for the following awards: